
FOX04 DRI 10mg

FOX04 DRI 10mg
FOXO4-DRI, an anti-aging peptide, selectively eliminates senescent cells by blocking the interaction between FOXO4 and p53. Its mechanisms of action include inducing apoptosis of senescent cells, improving tissue microenvironment, and delaying the aging process, demonstrating potential applications in anti-aging, treatment of testicular hypofunction, radiation-induced pulmonary fibrosis, neurodegenerative diseases, cardiovascular disease prevention, and other fields. By regulating signaling pathways and clearing senescent cells, it restores tissue function and provides new strategies for the treatment of multiple diseases.
The peptide will be provided as lyophilized powder to ensure maximum stability.
$500
Sequence
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
RUO — For research use only. Not for use in humans or animals.
- What is FOXO4-DRI?
- FOXO4-DRI Structure
- FOXO4-DRI Research
- Relevant Citations
Product Introduction
What is FOXO4-DRI?
The full name of FOXO4-DRI is FOXO4 D-Retro-Inverso. It is an anti-aging polypeptide that selectively induces the apoptosis of senescent cells by blocking the interaction between FOXO4 and p53, thereby improving the tissue microenvironment and delaying the aging process.
FOXO4-DRI Structure
Source: PubChem
Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Molecular Formula: C228H388N86O64
Molecular Weight: 5358g/mol
PubChem CID: 168431240
Synonyms: EX-A7431
FOXO4-DRI Research
What is the research background of FOXO4-DRI?
In-depth Research on Cellular Senescence:
With the continuous in-depth study of the mechanism of cellular senescence, it has been found that cellular senescence plays a key role in many physiological processes as well as the occurrence and development of diseases. Senescent cells will accumulate and secrete a variety of cytokines and inflammatory mediators, affecting the functions of surrounding cells, and thus leading to the decline of tissue and organ functions. Therefore, finding methods to intervene in the process of cellular senescence has become a research hotspot.
Discovery of FOXO4 Protein:
FOXO4 is a member of the forkhead box protein O family (FOXO) and plays an important role in various biological processes such as cell growth, differentiation, apoptosis, and stress response. Studies have found that FOXO4 is closely related to cellular senescence, and it can affect the senescence process of cells by regulating the expression of a series of genes. For example, FOXO4 can activate the expression of some antioxidant genes and DNA repair genes, enhancing the cell's resistance to oxidative stress and DNA damage, thereby delaying cellular senescence.
Screening of Small Molecule Compounds:
Based on the understanding of the function of the FOXO4 protein, scientists began to screen small molecule compounds that can regulate the activity of FOXO4. They hoped to find a small molecule substance that could specifically activate the FOXO4 protein, thus exerting its anti-aging effect and treating related diseases. After a large number of experimental screenings and optimizations, the small molecule compound FOXO4-DRI was finally discovered. It can specifically bind to the FOXO4 protein, activate its downstream signaling pathway, and play a role in regulating cellular senescence and related physiological functions.
What is the mechanism of action of FOXO4-DRI?
1. Anti-aging
FOXO4-DRI can activate the FOXO4 protein, and then regulate the cell's metabolism, proliferation, and apoptosis processes. The FOXO4 protein plays an important regulatory role in cells. It can enhance the cell's resistance to stress by regulating the expression of a series of downstream genes, and reduce cellular senescence and damage. For example, FOXO4 can promote the expression of antioxidant enzymes and reduce the level of intracellular reactive oxygen species, thus alleviating the damage of oxidative stress to cells[1, 2]. In addition, FOXO4 can also regulate the expression of genes related to the cell cycle, inhibit excessive cell proliferation, and maintain the normal metabolism and function of cells.
2. Mechanism of Action in Male Late-Onset Hypogonadism
Interaction with FOXO4 and p53:
Male late-onset hypogonadism is an age-related disease, and its core mechanism is the dysfunction of senescent Leydig cells in the testis. It has been found that the forkhead box O (FOXO) transcription factor FOXO4 is specifically expressed in human Leydig cells, and its translocation to the nucleus in the elderly is related to the decrease in testosterone synthesis. As a specific FOXO4 blocker, FOXO4-DRI selectively induces p53 nuclear exclusion and apoptosis in senescent Leydig cells by disrupting the interaction between FOXO4 and p53[1].
Improving the Testicular Microenvironment:
In naturally aged mice, FOXO4-DRI can improve the testicular microenvironment and alleviate age-related testosterone deficiency. This indicates that FOXO4-DRI may restore the normal function of testicular tissue by regulating the signaling pathway related to the senescence of Leydig cells, thereby increasing the testosterone secretion level[1].
3. Mechanism of Action in Pulmonary Fibrosis
Reducing Senescent Cells and Downregulating SASP Expression:
Pulmonary fibrosis is a progressive interstitial lung disease with limited treatment options. Cellular senescence is considered one of the pathogenic factors of pulmonary fibrosis, and the elimination of senescent cells can improve lung function. In a mouse model of pulmonary fibrosis induced by bleomycin, FOXO4-DRI, similar to the approved drug pirfenidone, can reduce senescent cells, downregulate the expression of the senescence-associated secretory phenotype (SASP), and alleviate the morphological changes and collagen deposition induced by bleomycin[2].
Influencing the Proportion of Cell Types:
FOXO4-DRI can increase the proportion of type 2 alveolar epithelial cells (AEC2) and fibroblasts and reduce the proportion of myofibroblasts in a mouse model of pulmonary fibrosis induced by bleomycin. In in vitro experiments, compared with mouse and human lung fibroblast cell lines, FOXO4-DRI has a greater tendency to kill myofibroblasts induced by transforming growth factor-β (TGF-β)[2].
Regulating the Extracellular Matrix Receptor Interaction Pathway:
The inhibitory effect of FOXO4-DRI on myofibroblasts leads to the downregulation of the extracellular matrix (ECM) receptor interaction pathway in bleomycin-induced pulmonary fibrosis. This indicates that FOXO4-DRI may improve the pathological process of pulmonary fibrosis by regulating the generation and metabolism of the ECM[2].
FOXO4-DRI ameliorates bleomycin (BLM)-induced pulmonary fibrosis (PF). (A) Schematic diagram illustrating the experimental design. (B) Representative scanned images of haematoxylin-eosin (HE) staining and Masson trichrome-staining of lung tissue sections.
Source:PubMed[2]
What are the applications of FOXO4-DRI?
FOXO4-DRI has potential value in improving age-related functional decline. With the increase of age, various organs and systems of the body will experience different degrees of aging and functional decline, such as the decrease in immune system function, the weakening of cardiovascular system function, and the decline of nervous system function. By activating the FOXO4 protein, FOXO4-DRI can delay the process of cellular senescence, improve cell vitality and function, and thus help improve the overall health of the body. For example, in an aged mouse model, treatment with FOXO4-DRI can significantly improve the exercise ability and cognitive function of the mice and reduce the occurrence of age-related diseases[1, 2].
2. Treatment of Neurodegenerative Diseases
Relationship with Neuron Aging and Death:
Neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease are closely related to the aging and death of neurons. In these diseases, neurons will be damaged by various factors such as oxidative stress, inflammatory response, and protein aggregation, leading to the gradual loss of neuronal function and ultimately causing cognitive and motor function disorders. By activating the FOXO4 signaling pathway, FOXO4-DRI can promote the survival and repair of neurons and enhance their resistance to oxidative stress and apoptotic signals.
The FOXO4 protein can regulate the expression of multiple genes in neurons, including antioxidant enzymes, anti-apoptotic proteins, nerve growth factors, etc. The upregulation of the expression of these genes can protect neurons from damage and promote the regeneration and repair of neurons. For example, in a mouse model of Alzheimer's disease, treatment with FOXO4-DRI can reduce the deposition of amyloid proteins, improve neuronal function, and slow down the progression of the disease. In a Parkinson's disease model, FOXO4-DRI can also protect dopaminergic neurons and improve the exercise ability of mice[3, 4]. Therefore, FOXO4-DRI is expected to be used in the treatment of neurodegenerative diseases to slow down the progression of the disease and improve the cognitive and motor functions of patients.
3. Prevention and Treatment of Cardiovascular Diseases
Protecting Cardiomyocytes:
In the cardiovascular system, FOXO4-DRI can protect cardiomyocytes from oxidative stress and apoptotic damage. Cardiomyocytes are the main functional cells of the heart, and their damage and death are one of the important causes of cardiovascular diseases. FOXO4-DRI can activate the FOXO4 protein, upregulate the expression of antioxidant enzymes, reduce the level of intracellular reactive oxygen species in cardiomyocytes, and alleviate the damage of oxidative stress to cardiomyocytes. At the same time, FOXO4-DRI can also promote the expression of anti-apoptotic proteins, inhibit the activation of the apoptotic signaling pathway, and protect cardiomyocytes from apoptosis[4].
Promoting the Function of Vascular Endothelial Cells:
FOXO4-DRI can also promote the normal function of vascular endothelial cells and maintain the stability and elasticity of blood vessels. Vascular endothelial cells are an important part of the blood vessel wall, and their abnormal function will lead to the occurrence of cardiovascular diseases such as increased vascular permeability, thrombosis, and atherosclerosis. FOXO4-DRI can activate the FOXO4 protein, regulate the expression of multiple genes in vascular endothelial cells, promote the proliferation, migration, and repair of vascular endothelial cells, and maintain the normal function of blood vessels. For example, FOXO4-DRI can upregulate the expression of vascular endothelial growth factor (VEGF), promote the proliferation of vascular endothelial cells and angiogenesis; it can also upregulate the expression of endothelial nitric oxide synthase (eNOS), promote the production of nitric oxide, dilate blood vessels, and reduce blood pressure [4].
Preventing and Treating Cardiovascular Diseases:
In summary, FOXO4-DRI helps prevent and treat cardiovascular diseases such as myocardial infarction, heart failure, and atherosclerosis. In an animal model of myocardial infarction, treatment with FOXO4-DRI can reduce the death of cardiomyocytes, promote the repair of myocardial tissue, and improve heart function. In a heart failure model, FOXO4-DRI can inhibit the apoptosis of cardiomyocytes, enhance myocardial contractility, and improve the pumping function of the heart. In an atherosclerosis model, FOXO4-DRI can reduce the damage of vascular endothelial cells, inhibit the inflammatory response, and reduce the risk of atherosclerosis[4].
In conclusion, through its mechanisms of action, including inducing the apoptosis of senescent cells, improving the tissue microenvironment, and delaying the aging process, FOXO4-DRI shows potential application value in the fields of anti-aging, treatment of testicular hypofunction, radiation-induced pulmonary fibrosis, neurodegenerative diseases, and prevention and treatment of cardiovascular diseases.
About The Author
The above-mentioned materials are all researched, edited and compiled by Corevia Peptides.
Scientific Journal Author
Han X is a researcher affiliated with multiple distinguished institutions, including the Jiangxi Academy of Sciences, Fudan University, Hunan University, Zhengzhou University, University of Geosciences, Sichuan University, National University of Singapore, Ministry of Natural Resources of the People's Republic of , Chinese Academy of Medical Sciences - Peking Union Medical College, Peking Union Medical College, Jiang Xi Acad Sci, Guilin Medical University, Tongji University, Medical University, Tianjin University, and Northeast Normal University - . These affiliations highlight his extensive and diverse academic background.
His research interests span across several key subject categories. He is actively engaged in research within the fields of Chemistry, Environmental Sciences & Ecology, Research & Experimental Medicine, Oncology, and Biochemistry & Molecular Biology. His work reflects a broad expertise and significant contributions to these areas. Han X is listed in the reference of citation [2].
Relevant Citations
[1] Zhang C, Xie Y, Chen H, et al. FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice[J]. Aging (Albany Ny), 2020,12(2):1272-1284.DOI:10.18632/aging.102682.
[2] Han X, Yuan T, Zhang J, et al. FOXO4 peptide targets myofibroblast ameliorates bleomycin-induced pulmonary fibrosis in mice through ECM-receptor interaction pathway[J]. Journal of Cellular and Molecular Medicine, 2022,26(11):3269-3280.DOI:10.1111/jcmm.17333.
[3] Theoharides T C, Tsilioni I. Tetramethoxyluteolin for the Treatment of Neurodegenerative Diseases[J]. Current Topics in Medicinal Chemistry, 2018,18(21):1872-1882.DOI:10.2174/1568026617666181119154247.
[4] Aslam D I, Jiyanboyevich Y, Ergashboevna A. Prevention & Treatment Of Cardiovascular Diseases[J]. The American Journal of Medical Sciences and Pharmaceutical Research, 2021,03:180-188.DOI:10.37547/TAJMSPR/Volume03Issue06-28.
Technical Information
Synonyms: EX-A7431
Downloads & Documents
Review available batch-specific testing documentation for FOX04 DRI 10mg, or contact us to request the certificate supplied with your batch.
Handling & Research Notice
- Reconstitute under sterile conditions and use aseptic technique.
- Store reconstituted material at 2-8°C and use within research protocol limits.
- Avoid repeated freeze-thaw cycles to preserve peptide integrity.
- For laboratory research use only — not for human or veterinary use, and not for diagnostic or therapeutic purposes.
Contact Us Now for A Quote
Wholesale pricing, batch COA documents and direct product support.



