Tesamorelin 20mg

Tesamorelin 20mg

Tesamorelin 20mg

Tesamoreli is a synthetic analog of growth hormone-releasing hormone, primarily indicated for treating HIV-related lipodystrophy syndrome, especially for visceral fat reduction. By emulating natural growth hormone-releasing hormone, it stimulates the anterior pituitary gland to secrete growth hormone, subsequently elevating levels of insulin-like growth factor 1, thereby eliciting various physiological responses. Regarding lipid metabolism, it enhances lipolysis and diminishes visceral fat, thereby alleviating abdominal fat accumulation in affected patients.

The peptide will be provided as lyophilized powder to ensure maximum stability.

$300

Model1kits(10Vials)
Purity≥99% (HPLC)
CAS Number218949-48-5
Molecular FormulaC221H366N72O67S
Molecular Weight5136 g/mol
PubChem CID16137828
SynonymsEgrifta
AvailabilityIn stock — ships in 1 business day

Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Send InquiryView COA

RUO — For research use only. Not for use in humans or animals.

  • Tesamoreli Overview
  • Tesamoreli Structure
  • Tesamoreli Research
  • Relevant Citations

Product Introduction

Tesamoreli Overview

Tesamoreli is a synthetic analog of growth hormone-releasing hormone (GHRH), which is mainly used to treat the abnormal accumulation of abdominal fat in HIV-infected individuals caused by antiretroviral therapy, and it has significant clinical significance and multiple advantages. By mimicking the GHRH produced by the human body itself, it stimulates the anterior pituitary gland to secrete growth hormone, thereby increasing the level of serum insulin-like growth factor I. This, in turn, helps to consume visceral fat and optimize fat distribution. In addition to reducing abdominal fat, it can also optimize body composition, enhance muscle strength, and increase bone density.

Tesamoreli Structure

Source: PubChem

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C221H366N72O67S

Molecular Weight: 5136 g/mol

CAS Number: 218949-48-5

PubChem CID: 16137828

Synonyms: Egrifta

Tesamoreli Research

What is the research background of Tesamoreli?

Recombinant human growth hormone (rhGH) has clinical effectiveness in the treatment of growth hormone (GH) deficiency, but it is also accompanied by various adverse side effects. This situation has prompted the development of human growth hormone-releasing factor (GFR) analogs, as they may have better tolerability. Tesamoreli is a synthetic GFR that has been developed as a potential treatment for a variety of diseases that may be related to a relative deficiency of GH, including HIV-associated lipodystrophy.

What are the mechanisms of action of Tesamoreli?

Mechanism of action on HIV-associated non-alcoholic fatty liver disease (NAFLD):

Regulation of gene expression:

In HIV-associated NAFLD, through gene set enrichment analysis, it was found that Tesamoreli increased the expression of the signature gene set related to oxidative phosphorylation in the liver, while reducing the expression of gene sets related to inflammation, tissue repair, and cell division [1]. Specifically, Tesamoreli down-regulated the liver gene sets related to inflammation, tissue repair, and cell division, indicating that it exerts its effect by regulating the expression of these genes.

Inhibition of key mediators:

Tesamoreli can inhibit key mediators of angiogenesis, fibrosis, and inflammation. For example, it can significantly reduce the levels of vascular endothelial growth factor A (VEGFA), transforming growth factor β1 (TGFB1), and macrophage colony-stimulating factor 1 (CSF1). In participants receiving Tesamoreli treatment, the decrease in VEGFA and CSF1 in the plasma was associated with a decrease in the non-alcoholic fatty liver disease activity score, and the decrease in TGFB1 and CSF1 was associated with a decrease in the gene-level fibrosis score[1]. As a regulator of monocyte recruitment and activation, CSF1 may become an innovative therapeutic target for HIV-associated NAFLD.

Mechanism of action on peripheral nerve injury:

In the treatment of peripheral nerve injury, Tesamoreli is believed to enhance axonal regeneration, reduce muscle atrophy, and improve functional outcomes. Current studies suggest that Tesamoreli may exert its effect by promoting the process of nerve regeneration and repair. The specific mechanism of action is not yet fully understood, but it may involve the regulation of nerve growth factors, the promotion of axonal growth, and myelination [2].

What is the specific mechanism of Tesamoreli in reducing visceral fat and liver fat in HIV-infected individuals?

Regulatory effect on growth hormone:

Stimulating growth hormone secretion:

Tesamoreli is a synthetic GHRH that can stimulate the secretion of growth hormone. In HIV-infected individuals, the secretion of growth hormone may be affected, and Tesamoreli can promote the anterior pituitary gland to release growth hormone by mimicking the action of GHRH[3-5].

Regulating fat metabolism:

Growth hormone plays an important role in fat metabolism. It can promote lipolysis, increase the oxidation of fatty acids, and reduce fat accumulation. By stimulating the secretion of growth hormone, Tesamoreli may indirectly regulate fat metabolism and reduce the accumulation of visceral fat and liver fat[3-5].

Influence on liver gene expression:

Altering gene pathways:

Studies have found that Tesamoreli can increase the expression of the signature gene set related to oxidative phosphorylation in the liver, while reducing the expression of gene sets related to inflammation, tissue repair, and cell division[1].

Affecting genes related to the prognosis of hepatocellular carcinoma:

Tesamoreli can also regulate the gene sets related to the prognosis of hepatocellular carcinoma, up-regulating the gene sets related to a good prognosis and down-regulating the gene sets related to a poor prognosis, respectively [1]. These changes in gene expression may be related to the effect of Tesamoreli on reducing liver fat.

Relationship with fibrosis-related gene scores:

In participants treated with Tesamoreli, these changes in liver expression were associated with improved fibrosis-related gene scores. This indicates that Tesamoreli may reduce liver fat by regulating liver gene expression and improving the fibrotic condition of the liver [1].

Effect on plasma proteins:

Inhibiting key mediators:

Tesamoreli can significantly reduce the levels of plasma proteins such as vascular endothelial growth factor A (VEGFA), transforming growth factor β1 (TGFB1), and macrophage colony-stimulating factor 1 (CSF1) [1]. These proteins are related to angiogenesis, fibrosis, and inflammation, and the inhibition of them by Tesamoreli may help reduce liver fat and inflammation.

Source:PubMed[1]

What are the applications of Tesamoreli?

Effect on HIV-infected individuals:

Reducing visceral fat and liver fat:

Some studies have shown that in HIV-infected individuals receiving integrase inhibitor (INSTIs) treatment, the increase in visceral adipose tissue (VAT) is a matter of concern because VAT is associated with downstream comorbidities such as non-alcoholic fatty liver disease (NAFLD). Tesamoreli has been shown to reduce VAT in HIV-infected individuals with lipohypertrophy by more than 15% within 6 months [6]. In a placebo-controlled trial of 61 participants with HIV-associated NAFLD, a post-hoc analysis of individuals receiving INSTIs treatment found that after 12 months, VAT in the placebo group increased by 10.8%, while VAT in the Tesamoreli treatment group decreased by 8.3% overall. In addition, the liver fat fraction (HFF) in the Tesamoreli treatment group decreased by 31% relative to the baseline, which was significantly higher than that in the placebo treatment group[6].

Improving fat quality:

In HIV-infected individuals, in patients with central obesity who used Tesamoreli, the density of visceral fat (VAT) and subcutaneous fat (SAT) increased, and this increase was independent of changes in fat mass, indicating that Tesamoreli can also improve the quality of VAT and SAT in this group of patients [7].

Effect on immune function:

Long-term use of Tesamoreli can reduce the markers of T cell and monocyte/macrophage activity in the circulation of HIV-infected individuals and down-regulate the immune pathways in the liver. Specifically, compared with the placebo, Tesamoreli reduced the circulating concentrations of 13 proteins, including four chemokines, two cytokines, four T cell-related molecules, as well as arginase-1, galectin-9, and hepatocyte growth factor. Network analysis showed a close interaction between the gene pathways responsible for reducing these proteins, and targeted transcriptomics confirmed the down-regulation signal of the immune pathways in the liver [8].

Effect in non-alcoholic fatty liver disease:

Reducing liver fat and preventing fibrosis progression:

In HIV-associated non-alcoholic fatty liver disease, Tesamoreli has been shown to reduce liver fat and prevent fibrosis progression. Researchers conducted a focused evaluation of 9 plasma proteins corresponding to the top leading edge genes in the differentially regulated gene sets and found that Tesamoreli led to a significant reduction in vascular endothelial growth factor A (VEGFA), transforming growth factor β1 (TGFB1), and macrophage colony-stimulating factor 1 (CSF1). In participants treated with Tesamoreli, the decrease in VEGFA and CSF1 in the plasma was associated with a decrease in the non-alcoholic fatty liver disease activity score, and the decrease in TGFB1 and CSF1 was associated with a decrease in the gene-level fibrosis score. As a regulator of monocyte recruitment and activation, CSF1 may become an innovative therapeutic target for non-alcoholic fatty liver disease in HIV[1].

Influence on the liver transcriptome signature:

Using gene set enrichment analysis, it was found that Tesamoreli increased the liver expression of the signature gene set related to oxidative phosphorylation and reduced the liver expression of gene sets related to inflammation, tissue repair, and cell division. In addition, Tesamoreli also up-regulated and down-regulated the selected gene sets related to good and poor prognosis of hepatocellular carcinoma, respectively. In participants treated with Tesamoreli, these changes in liver expression were associated with improved fibrosis-related gene scores[9].

In conclusion, as a synthetic analog of growth hormone-releasing hormone, Tesamoreli has demonstrated therapeutic potential in multiple aspects. A large number of studies have confirmed that it can effectively regulate the secretion of growth hormone and improve human metabolic function. In the treatment of HIV infection-related diseases, it has a significant effect on reducing abdominal fat accumulation. By stimulating the secretion of growth hormone and optimizing fat metabolism, it reduces the amount of visceral fat without affecting lean body mass, and plays a positive role in adjusting the body composition of patients. In the treatment of non-alcoholic fatty liver disease, some studies have also shown that it can reduce the fat content in the liver. Tesamoreli is of great significance. For HIV-infected patients, it provides an effective means to improve the fat metabolism disorder caused by the disease and treatment, improves the quality of life of patients, helps relieve the psychological pressure caused by changes in appearance, and enhances their sense of social integration. Unit introduction

About The Author

The above-mentioned materials are all researched, edited and compiled by Corevia Peptides.

Scientific Journal Author

Stanley T L is a scholar at Harvard University, engaged in research and teaching at institutions such as Harvard Medical School and Massachusetts General Hospital. His research fields include endocrinology and metabolism, infectious diseases, immunology, microbiology, and nutrition and dietetics. He has conducted in-depth explorations in these fields, providing theoretical bases for the diagnosis, treatment, and prevention of related diseases. At the same time, he closely cooperates with organizations such as Harvard Medical School and Massachusetts General Hospital for Children, combining theory with clinical practice and making contributions to the medical cause. Stanley T L is listed in the reference of citation [5].

Relevant Citations

[1] Fourman L T, Billingsley J M, Agyapong G, et al. Effects of tesamorelin on hepatic transcriptomic signatures in HIV-associated NAFLD[J]. Jci Insight, 2020,5(16).DOI:10.1172/jci.insight.140134.

[2] Jaimie T S. Tesamoreli Therapy to Enhance Axonal Regeneration, Minimize Muscle Atrophy and Improve Functional Outcomes Following Peripheral Nerve Injury and Repair[J]. 2015.

[3] Rahman F, McLaughlin T, Mesquita P, et al. Effect of tesamorelin in people with HIV with and without dorsocervical fat: Post hoc analysis of phase III double-blind placebo-controlled trial[J]. Journal of Clinical and Translational Science, 2022,7(1).DOI:10.1017/cts.2022.515.

[4] Mateo M G, Gutierrez M D M, Domingo P. Tesamoreli for the treatment of excess abdominal fat in HIV-1-infected patients with lipodystrophy.[J]. Expert Review of Endocrinology & Metabolism, 2011,6(1):21-30.DOI:10.1586/eem.10.83.

[5] Stanley T L, Falutz J, Marsolais C, et al. Reduction in Visceral Adiposity Is Associated With an Improved Metabolic Profile in HIV-Infected Patients Receiving Tesamoreli[J]. Clinical Infectious Diseases, 2012,54(11):1642-1651.DOI:10.1093/cid/cis251.

[6] McLaughlin T, Grinspoon S K, Stanley T, et al. 1499. Tesamoreli Reduces Visceral Adipose Tissue and Liver Fat in INSTI-Treated Persons with HIV[J]. Open Forum Infectious Diseases, 2023,10(2):500-1334.DOI:10.1093/ofid/ofad500.1334.

[7] Lake J E, La K, Erlandson K M, et al. Tesamoreli improves fat quality independent of changes in fat quantity[J]. Aids, 2021,35(9):1395-1402.DOI:10.1097/QAD.0000000000002897.

[8] Stanley T L, Fourman L T, Wong L P, et al. Growth Hormone Releasing Hormone Reduces Circulating Markers of Immune Activation in Parallel with Effects on Hepatic Immune Pathways in Individuals with HIV-infection and Nonalcoholic Fatty Liver Disease[J]. Clinical Infectious Diseases, 2021,73(4):621-630.DOI:10.1093/cid/ciab019.

[9] Fourman L T, Stanley T L, Billingsley J M, et al. Delineating tesamorelin response pathways in HIV-associated NAFLD using a targeted proteomic and transcriptomic approach[J]. Scientific Reports, 2021,11(1).DOI:10.1038/s41598-021-89966-y.

Technical Information

Product NameTesamorelin 20mg
Model1kits(10Vials)
Purity≥99% (HPLC)
CAS Number218949-48-5
Molecular FormulaC221H366N72O67S
Molecular Weight5136 g/mol
PubChem CID16137828
AppearanceWhite to off-white lyophilised powder
SolubilitySoluble in bacteriostatic water / sterile water
StorageStore lyophilised at -20°C, protected from light
ShippingAmbient temperature; ships in 1 business day
TestingBatch-specific HPLC / MS documentation available

Synonyms: Egrifta

Downloads & Documents

Review available batch-specific testing documentation for Tesamorelin 20mg, or contact us to request the certificate supplied with your batch.

Handling & Research Notice

  • Reconstitute under sterile conditions and use aseptic technique.
  • Store reconstituted material at 2-8°C and use within research protocol limits.
  • Avoid repeated freeze-thaw cycles to preserve peptide integrity.
  • For laboratory research use only — not for human or veterinary use, and not for diagnostic or therapeutic purposes.

Related Products

Get in touch

Contact Us Now for A Quote

Wholesale pricing, batch COA documents and direct product support.

Request a Research Quote